PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G51080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 281aa    MW: 30373.1 Da    PI: 7.3323
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G51080.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP51.82.2e-161011344578
                   TTSSEEETTT--SS--S-STTTT-------S--- CS
           SBP  45 qCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    C+ fh l efDeekrsCr+rL++hn+rrrk+q+
  OB01G51080.1 101 TCGWFHLLGEFDEEKRSCRKRLDGHNKRRRKPQP 134
                   6******************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114112.72545132IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.107.3E-5101119IPR004333Transcription factor, SBP-box
PfamPF031103.8E-9101131IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-13101137IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MQLGACICPP VLLLPRDTIV FCPHDDAAAA AAADGQNTTE LGLAGGPCVA VAFVAHLTRA  60
TNSSPDIHLN AKTNLAVPSV PHVFHPGKLH GQLLDLTDLD TCGWFHLLGE FDEEKRSCRK  120
RLDGHNKRRR KPQPDPLNPS SLFANHHGAA RFTSYQQIFS TASMSQEAKW PVSAVKTEAD  180
VFQEPYYHGL HLNGGAAASI FHGKGRKHHF PFLTTDHGDA AAAAPFGCQP FTITPSSAES  240
RSSSSSRHSN GGKMFAAHDG ACLVFPVYGE YHPTYDSQLH Y
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114131KRSCRKRLDGHNKRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0625811e-116AK062581.1 Oryza sativa Japonica Group cDNA clone:001-100-B10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015690794.11e-110PREDICTED: squamosa promoter-binding-like protein 2
SwissprotQ0JGI18e-65SPL2_ORYSJ; Squamosa promoter-binding-like protein 2
TrEMBLJ3L7A20.0J3L7A2_ORYBR; Uncharacterized protein
STRINGOB01G51080.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104563038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.12e-14SBP family protein